PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00080.1.g00460.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 686aa    MW: 73399.5 Da    PI: 6.2712
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00080.1.g00460.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.91.1e-1065108245
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45 
                                   ++  +++ +q+++Le+ F+++ +p++e+r+ LA k+g++ +qVk
  Zpz_sc00080.1.g00460.1.am.mk  65 STYKRHSMQQIQALEASFNRCAHPDEEMRKALAVKIGMEPTQVK 108
                                   56778999***********************************8 PP

2START78.91.3e-252324463203
                                   HHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
                         START   3 aeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWde 74 
                                   ae+a +e++++a+a+ p+W   +   e +n  e+  +  +         + + a r++gvv +++ +lv  l d + +W++
  Zpz_sc00080.1.g00460.1.am.mk 232 AERAVREFLALAAAGVPMWLPTAgngEVLNFGEYAARMFPRLLgpcpqgFVSVATRETGVVWAAPGDLVGVLTDAG-RWSQ 311
                                   68899999999999999999999888666666665555443336888888999***********************.**** PP

                                   T-S...EEEEEEEECTTEEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--...-TTSEE-EES CS
                         START  75 tla...kaetlevissggalqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe..sssvvRaell 148
                                   +++   +a t   + s g l       q+ sp vp   + f+R+++  +++ +w++vdvS+d    + +    +  R++l 
  Zpz_sc00080.1.g00460.1.am.mk 312 MFPgivAAVTARDVGSSGMLGPPDGLIQL-SPRVPnHSVKFLRFTKMmENGRQWAVVDVSIDAILAVGQegGVEHTRCGLM 391
                                   ***98766666677777888888888888.9*99*9999********99999**********99998865667778***** PP

                                   SEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
                         START 149 pSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                                   pSg+lie++++g skvtw+ h+++++ +++ l+r+++ sg+a ga +w+atl+r 
  Zpz_sc00080.1.g00460.1.am.mk 392 PSGCLIEEMDGGCSKVTWIVHAEYDETSVPPLFRPFLPSGQALGACRWLATLKRK 446
                                   ****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-1148108IPR009057Homeodomain-like
SuperFamilySSF466897.27E-948108IPR009057Homeodomain-like
SMARTSM003890.00563117IPR001356Homeobox domain
CDDcd000865.60E-964108No hitNo description
PfamPF000465.1E-866108IPR001356Homeobox domain
PROSITE profilePS5084824.677221452IPR002913START domain
CDDcd088757.25E-74226445No hitNo description
SuperFamilySSF559611.1E-15229445No hitNo description
SMARTSM002341.2E-5230449IPR002913START domain
PfamPF018523.1E-19232446IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MENEGAHHTS NVDDASLTTG TDDASEQIWD SEEFDIDALL EDEDASASTD NDAQQSDAQG  60
SKVRSTYKRH SMQQIQALEA SFNRCAHPDE EMRKALAVKI GMEPTQVKHC VHHLCLNSSF  120
ATASDWSAHQ YAQVKLLSQA NNQLHGQNAF LKAENVALRK RVLQRSCFAC VCLMAPPELL  180
TGKQRLIVEN ARLKEAYQRA QTRLKELSRG APLPLAAPSI AQDHAALLLH HAERAVREFL  240
ALAAAGVPMW LPTAGNGEVL NFGEYAARMF PRLLGPCPQG FVSVATRETG VVWAAPGDLV  300
GVLTDAGRWS QMFPGIVAAV TARDVGSSGM LGPPDGLIQL SPRVPNHSVK FLRFTKMMEN  360
GRQWAVVDVS IDAILAVGQE GGVEHTRCGL MPSGCLIEEM DGGCSKVTWI VHAEYDETSV  420
PPLFRPFLPS GQALGACRWL ATLKRKYEFM GILKNSFPAA GDGNKVVMEM ARRMTASFYA  480
AISGPATLPG STVREWRGGS GTGGDERFQA SVRMVIWTCV GGVPGRPASV QVLSATTTVW  540
LPGTEPRLVL DYLCDERRRD EWDVLAAGGA VNVTGPIEET TVLAIANGGD PASGFLLPSG  600
FAILPDGHRK ASRAPAAAAS SSSGAPPPWH RTTTGCLLTA AYQTLLPAEP PTANLPAGAF  660
DVVGKQLCLA IDKVKVAVEA DVVVAA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-85protodermal factor 2